// PROJECT 01Qa Ai Automation
Playwright AI Test Generator
Takes natural language descriptions of user workflows and generates complete, runnable Playwright test scripts in Python. Uses NLP to parse user intent, maps ac...
flaskpytestplaywrightpytest-playwright
// PROJECT 02Qa Ai Automation
LangGraph QA Agent
An autonomous testing agent with multi-node graph architecture: test planning, execution, bug analysis, self-healing locators, and result reporting with conditi...
sentence-transformerstorchnumpypytest
// PROJECT 03Qa Ai Automation
Self-Healing Locator Engine
When UI automation tests break due to changed selectors, this tool automatically finds the best alternative locator using DOM similarity scoring, attribute fuzz...
beautifulsoup4scikit-learnnumpypytest
// PROJECT 04Qa Ai Automation
AI Visual Regression Tester
Uses computer vision (SSIM, perceptual hashing) to detect and classify visual differences between baseline and current screenshots as layout shift, color change...
Pillowscikit-imagenumpypytest
// PROJECT 05Qa Ai Automation
BDD Scenario Generator
Takes plain English requirements or user stories and generates complete Gherkin/Cucumber BDD scenarios with Given/When/Then steps, edge cases, and .feature file...
nltkpytest
// PROJECT 06Qa Ai Automation
AI Test Data Generator
Generates realistic, schema-aware test data for any domain. Supports insurance policies, user profiles, transactions, API payloads with boundary value and negat...
numpyscikit-learnpytest
// PROJECT 07Qa Ai Automation
Flaky Test Detector
Analyzes test execution history from JUnit XML reports to identify flaky tests using statistical analysis and ML classification. Outputs HTML reports ranking te...
numpyscikit-learnpytest
// PROJECT 08Qa Ai Automation
AI API Contract Validator
Takes an OpenAPI/Swagger spec and automatically generates comprehensive API test cases including happy path, edge cases, boundary values, type mismatches, and s...
requestspyyamlpytestpytest-cov
// PROJECT 09Qa Ai Automation
AI Bug Triager
Automatically classifies bug reports by severity, category, affected component, and suggested assignee using NLP with TF-IDF and scikit-learn classifiers. Inclu...
scikit-learnflasknumpypytest
// PROJECT 10Qa Ai Automation
RAG QA Knowledge Base
A retrieval-augmented generation system for QA teams. Upload test documentation and runbooks, ask natural language questions, get grounded answers with source c...
fastapiuvicornpython-multipartjinja2
// PROJECT 11Qa Ai Automation
Insurance Document Analyzer
An NLP pipeline that processes insurance policy documents to extract coverage types, limits, deductibles, exclusions, dates, and endorsements. Validates against...
nltkscikit-learnnumpypytest
// PROJECT 12Rag
AI Study Assistant
A RAG system enabling users to upload documents (PDF, TXT, Markdown) and receive AI-generated answers grounded in their own material with source citations. Uses...
FastAPIFAISSsentence-transformersAnthropic Claude
// PROJECT 13Ai Safety
RAG QA Evaluator
An automated evaluation framework for RAG chatbot systems built for P&C insurance policy documents. Evaluates answer quality across groundedness, relevance, lat...
ChromaDBNVIDIA NIMLlama 3.1behave (BDD)
// PROJECT 14Agentic Ai
Local AI QA Engineer
An autonomous AI agent that navigates websites, finds bugs, generates Playwright tests, captures screenshots, and produces structured test reports with severity...
PlaywrightNVIDIA NIMNemotron-120BLlama 3.2
// PROJECT 15Vector Search
Second Brain (AI Bookmark Manager)
An AI-assisted bookmark manager that saves, organizes, and retrieves web pages. Fetches metadata, generates extractive summaries, creates tags, and provides sem...
FlaskBeautiful SoupSQLite FTS5scikit-learn
// PROJECT 16Llm Tools
AI Resume Analyzer & ATS Optimizer
A web application that analyzes resumes against job descriptions to provide ATS compatibility scoring, keyword gap analysis, and AI-powered bullet point rewrite...
Flaskpdfplumberpython-docxAnthropic Claude
// PROJECT 17Llm Tools
AI Meeting Summarizer
Transforms unstructured meeting notes into structured, actionable summaries with key decisions, prioritized action items with assignees and due dates, and times...
PythonLLM API
// PROJECT 18Automation
JyotishTrader
An automated stock trading system that applies Vedic astrology principles (eight-layer analysis including Graha Drishti, Vimshottari Dasha, Yogas, Nakshatras) t...
StreamlitZerodha Kite ConnectAlpaca APISQLite
// PROJECT 19Qa Ai Automation
TestPilot AI - Intelligent Test Generation Framework
A pip-installable test generation framework using AST parsing. Generates comprehensive pytest suites with boundary value analysis, equivalence partitioning, and...
clickpydanticpytestjinja2
// PROJECT 20Nlp
Smart Text Similarity Engine
A text similarity engine that combines TF-IDF, cosine similarity, and Jaccard distance to find semantically similar documents. Useful for plagiarism detection, ...
scikit-learnpandasnltknumpy
// PROJECT 21Model Serving
Real-Time ML Inference Server
FastAPI + WebSocket real-time ML inference server with batched prediction, model hot-reloading, A/B testing, health monitoring, and in-memory feature cache.
fastapiuvicornwebsocketsscikit-learn
// PROJECT 22Guardrails
PromptGuard - LLM Output Validation Framework
A pip-installable guardrails library for validating LLM outputs. Enforces schema compliance, detects PII leaks, scores hallucination risk, filters toxic content...
pydanticclickpyyamlpytest
// PROJECT 23Multi Agent
Multi-Agent Code Review System
Multi-agent system with specialized agents (Security, Performance, Style, Orchestrator) collaborating via message-passing architecture for comprehensive code re...
pydanticclickrichpytest
// PROJECT 24Recommendation System
Mood-Based Music Recommender
An ML-powered recommendation engine that analyzes text input describing your current mood and recommends music genres, tempo ranges, and synthetic playlists usi...
scikit-learnpandasnumpynltk
// PROJECT 25Mlops
ML Experiment Tracker
Lightweight experiment tracking system. Log hyperparameters, metrics, artifacts. Compare experiments with Flask dashboard. SQLite-backed, zero-config.
flaskpandasmatplotlibclick
// PROJECT 26Mlops
LogPilot - AI-Powered Log Analysis CLI
A pip-installable CLI for intelligent log analysis. Parses logs, detects anomalies using statistical methods and clustering, identifies root causes, generates i...
clickscikit-learnpandasnumpy
// PROJECT 27Knowledge Graph
Knowledge Graph Builder
Extracts entities and relationships from text using NLP, builds queryable knowledge graph with NetworkX. Shortest path, PageRank, connected components. FastAPI ...
networkxnltkfastapiuvicorn
// PROJECT 28Api Ai Service
GraphQL AI Gateway - Unified AI Model API
GraphQL API gateway over multiple AI models. Task-based routing, response caching, rate limiting, request batching. Strawberry GraphQL + FastAPI.
strawberry-graphqlfastapiuvicornscikit-learn
// PROJECT 29Feature Store
Feature Store Lite - Lightweight ML Feature Store
Lightweight feature store for ML workflows. Feature registration with schemas, versioned feature sets, point-in-time lookups, REST API for online serving. SQLit...
fastapiuvicornpandaspyarrow
// PROJECT 30Real Time Ai
Event-Driven ML Pipeline - Real-Time Stream Processing
Event-driven stream processing for real-time ML inference. Async message broker, windowed aggregation, real-time features, online prediction. No external broker...
fastapiuvicornscikit-learnnumpy
// PROJECT 31Vector Search
EmbedKit - Production Embedding Pipeline Toolkit
A pip-installable toolkit for building embedding pipelines. Multiple chunking strategies, embedding generation with caching, unified vector store interface supp...
sentence-transformersfaiss-cpunumpyclick
// PROJECT 32Data Engineering
DataWeave - Declarative Data Pipeline Framework
A pip-installable data pipeline framework with YAML-defined ETL workflows. Built-in operators for transform, validate, profile, and load data with HTML profilin...
pandaspydanticpyyamlclick
// PROJECT 33Data Engineering
Data Quality Sentinel - Automated Data Validation Framework
Automated data validation framework. YAML expectations, 12+ check types, statistical anomaly detection, HTML reports with trend tracking.
pandaspydanticpyyamljinja2
// PROJECT 34Workflow Orchestration
DAG Workflow Engine - ML Pipeline Orchestrator
DAG-based workflow orchestration for ML pipelines. YAML task dependencies, topological execution with parallelism, retry with backoff, state persistence.
networkxpydanticpyyamlclick
// PROJECT 35Qa Ai Automation
API Chaos Tester - Intelligent API Fuzz Testing
Intelligent API testing from OpenAPI specs. ML failure prediction, property-based testing, chaos strategies (boundary, type confusion, null injection, Unicode),...
httpxpydanticpyyamlscikit-learn
